CAS: 154947-66-7
The sole human cathelicidin-derived antimicrobial peptide, consisting of 37 amino acid residues. LL-37 (CAS 154947-66-7) is extensively used in microbiological and immunological research studying host defense peptide-membrane interactions, innate immunity signaling, and biofilm disruption mechanisms.
4493.33 g/mol
Store at -20°C, desiccated. Protect from light. Avoid repeated freeze-thaw cycles.
Reconstitute in sterile endotoxin-free water or PBS. Use polypropylene tubes to minimize adsorption. Aliquot and store at -20°C.
[LL-37, 37 aa]
Research Use Only: This product is intended for in-vitro laboratory research use only. Not for human consumption or therapeutic application. By purchasing, you confirm this product will be used exclusively for qualified research purposes.